PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01439.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 506aa    MW: 54229.1 Da    PI: 11.201
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01439.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH110.000791261681055
                                   HHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                           HLH  10 rrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                                   rrR + +  ++e Lr+l+P++   ++   +    L  A  YI  Lq
  Zpz_sc01439.1.g00110.1.am.mk 126 RRRDAAVTRRMEALRRLVPTS---YGDQDDELLLLSAAAGYIARLQ 168
                                   777788999***********9...9*****************9998 PP

2GATA56.92.9e-18411444134
                          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                   C++C + +Tp+WR+gp+g++tLCnaCG+++++ +
  Zpz_sc01439.1.g00110.1.am.mk 411 CTHCASEETPQWRQGPEGPSTLCNACGVRFKSGR 444
                                   *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.55116167IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.3E-5126182IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.66E-8126189IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5011412.149405441IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-16405459IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-14407468No hitNo description
Gene3DG3DSA:3.30.50.105.8E-14409442IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.13E-14410459No hitNo description
PROSITE patternPS003440411436IPR000679Zinc finger, GATA-type
PfamPF003204.8E-16411444IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MGAPTGRRRC SASSASMRAR LPVASAVPSR RLPSSYRTTS XXTRCNGLSP RLLVTISLQS  60
ATTIYKADSI VAMGAPTGRR RCSASSASMR ARLPVASAVP SRRLPSSYRT TSTKASGGDG  120
KVRSSRRRDA AVTRRMEALR RLVPTSYGDQ DDELLLLSAA AGYIARLQAQ VRVMQLMANI  180
LEHAQEAPQV PARPRERRGF ITLVKTYGFP GSPPRNPAEI LPPSLSPEFV KPLRYKPKSP  240
NQSRKADDKW PPDHPFKQST ENSISLSCGA LTVAAAAATM AGVGAADKNA AAAVADELAG  300
GLDASLSAFF DHAGLESAVA EGGERAEEEE EELEWLSNMD AFPSVDTMAV EAEAAPSSSR  360
PLVGLGRLPH VVGPRTKGLR RRRRVTAPWN LPPLQPPPPP PASGGAPRRR CTHCASEETP  420
QWRQGPEGPS TLCNACGVRF KSGRLFPEYR PINSPTFSPL LHSNSHRRVL EMRRHVEDEA  480
ATASGGGARA RRAERAAARS AAAKAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.15e-32GATA transcription factor 12